PDB entry 1w8m

View 1w8m on RCSB PDB site
Description: enzymatic and structural characterisation of non peptide ligand cyclophilin complexes
Class: isomerase
Keywords: 3d-structure, complex (isomerase/immunosuppressant), non peptide ligand, isomerase, multigene family, rotamase
Deposited on 2004-09-24, released 2004-09-30
The last revision prior to the SCOP 1.75 freeze date was dated 2004-09-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.132
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1w8ma_
  • Heterogens: E1P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w8mA (A:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle