Lineage for d1w80a1 (1w80 A:694-824)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658307Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (3 families) (S)
    contains an additional N-terminal strand
  5. 658308Family b.1.10.1: Alpha-adaptin ear subdomain-like [49349] (2 proteins)
    ear domain consists of two different subdomains
  6. 658309Protein Alpha-adaptin AP2 ear domain, N-terminal subdomain [49350] (1 species)
  7. 658310Species Mouse (Mus musculus) [TaxId:10090] [49351] (9 PDB entries)
  8. 658316Domain d1w80a1: 1w80 A:694-824 [114333]
    Other proteins in same PDB: d1w80a2
    complexed with two synaptojanin 1 peptides, chains P and Q
    complexed with bdn, co3, dtd, so4

Details for d1w80a1

PDB Entry: 1w80 (more details), 1.9 Å

PDB Description: crystal structure of the alpha-adaptin appendage domain, from the ap2 adaptor complex, bound to 2 peptides from synaptojanin170
PDB Compounds: (A:) adapter-related protein complex 2 alpha 2 subunit

SCOP Domain Sequences for d1w80a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w80a1 b.1.10.1 (A:694-824) Alpha-adaptin AP2 ear domain, N-terminal subdomain {Mouse (Mus musculus) [TaxId: 10090]}
laplapgsednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqflnft
ptlicaddlqtnlnlqtkpvdptvdggaqvqqviniecisdfteapvlniqfryggtfqn
vsvklpitlnk

SCOP Domain Coordinates for d1w80a1:

Click to download the PDB-style file with coordinates for d1w80a1.
(The format of our PDB-style files is described here.)

Timeline for d1w80a1: