![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (3 families) ![]() contains an additional N-terminal strand |
![]() | Family b.1.10.1: Alpha-adaptin ear subdomain-like [49349] (2 proteins) ear domain consists of two different subdomains |
![]() | Protein Alpha-adaptin AP2 ear domain, N-terminal subdomain [49350] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [49351] (9 PDB entries) |
![]() | Domain d1w80a1: 1w80 A:694-824 [114333] Other proteins in same PDB: d1w80a2 complexed with two synaptojanin 1 peptides, chains P and Q complexed with bdn, co3, dtd, so4 |
PDB Entry: 1w80 (more details), 1.9 Å
SCOP Domain Sequences for d1w80a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w80a1 b.1.10.1 (A:694-824) Alpha-adaptin AP2 ear domain, N-terminal subdomain {Mouse (Mus musculus)} laplapgsednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqflnft ptlicaddlqtnlnlqtkpvdptvdggaqvqqviniecisdfteapvlniqfryggtfqn vsvklpitlnk
Timeline for d1w80a1: