![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) ![]() contains an additional N-terminal strand |
![]() | Family b.1.10.1: Alpha-adaptin ear subdomain-like [49349] (2 proteins) ear domain consists of two different subdomains automatically mapped to Pfam PF02883 |
![]() | Protein Alpha-adaptin AP2 ear domain, N-terminal subdomain [49350] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [49351] (10 PDB entries) Uniprot P17427 694-938 # 98% sequence identity |
![]() | Domain d1w80a1: 1w80 A:694-824 [114333] Other proteins in same PDB: d1w80a2, d1w80a3 complexed with two synaptojanin 1 peptides, chains P and Q complexed with ben, co3, dtd, so4 |
PDB Entry: 1w80 (more details), 1.9 Å
SCOPe Domain Sequences for d1w80a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w80a1 b.1.10.1 (A:694-824) Alpha-adaptin AP2 ear domain, N-terminal subdomain {Mouse (Mus musculus) [TaxId: 10090]} laplapgsednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqflnft ptlicaddlqtnlnlqtkpvdptvdggaqvqqviniecisdfteapvlniqfryggtfqn vsvklpitlnk
Timeline for d1w80a1: