SCOP 1.71: Domain d1w72l1: 1w72 L:1-107

Lineage for d1w72l1 (1w72 L:1-107)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Human (Homo sapiens), cluster 5 [TaxId:9606] [88540] (4 PDB entries)

8. Domain d1w72l1: 1w72 L:1-107 [114303]
   Other proteins in same PDB: d1w72a1, d1w72a2, d1w72b_, d1w72d1, d1w72d2, d1w72e_, d1w72h1, d1w72h2, d1w72i1, d1w72i2, d1w72l2, d1w72m2

Details for d1w72l1

PDB Entry: 1w72, 2.15 Å

PDB Description: crystal structure of hla-a1:mage-a1 in complex with fab-hyb3

SCOP Domain Sequences for d1w72l1:

Sequence; same for both SEQRES and ATOM records:

>d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5}
syvltqppsvsvapgqtaritcggnnigsrsvhwyqqkpgqapvlvvyddsdrpsgiper
fsgsnsgnmatltisrveagdeadyycqvwdsrtdhwvfgggtdltvlg

Timeline for d1w72l1:

• d1w72l1 is new in SCOP 1.71
  
• d1w72l1 appears in SCOP 1.73
  
• d1w72l1 appears in the current release, SCOPe 2.08