Lineage for d1w72h2 (1w72 H:114-228)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549023Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 549027Species Human (Homo sapiens) [TaxId:9606] [88575] (105 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 549057Domain d1w72h2: 1w72 H:114-228 [114300]
    Other proteins in same PDB: d1w72a1, d1w72a2, d1w72b_, d1w72d1, d1w72d2, d1w72e_, d1w72h1, d1w72i1, d1w72l1, d1w72l2, d1w72m1, d1w72m2

Details for d1w72h2

PDB Entry: 1w72 (more details), 2.15 Å

PDB Description: crystal structure of hla-a1:mage-a1 in complex with fab-hyb3

SCOP Domain Sequences for d1w72h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w72h2 b.1.1.2 (H:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOP Domain Coordinates for d1w72h2:

Click to download the PDB-style file with coordinates for d1w72h2.
(The format of our PDB-style files is described here.)

Timeline for d1w72h2: