SCOPe 2.07: Domain d1w72d2: 1w72 D:1-181

Lineage for d1w72d2 (1w72 D:1-181)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-A1 [TaxId:9606] [117849] (2 PDB entries)
   Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor

8. Domain d1w72d2: 1w72 D:1-181 [114297]
   Other proteins in same PDB: d1w72a1, d1w72b1, d1w72b2, d1w72d1, d1w72e1, d1w72e2, d1w72h1, d1w72h2, d1w72i1, d1w72i2, d1w72l1, d1w72l2, d1w72m1, d1w72m2
   complexed with gol

Details for d1w72d2

PDB Entry: 1w72, 2.15 Å

PDB Description: crystal structure of hla-a1:mage-a1 in complex with fab-hyb3

PDB Compounds: (D:) hla class I histocompatibility antigen

SCOPe Domain Sequences for d1w72d2:

Sequence; same for both SEQRES and ATOM records:

>d1w72d2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqkmeprapwieqegpeyw
dqetrnmkahsqtdranlgtlrgyynqsedgshtiqimygcdvgpdgrflrgyrqdaydg
kdyialnedlrswtaadmaaqitkrkweavhaaeqrrvylegrcvdglrrylengketlq
r

Timeline for d1w72d2:

• d1w72d2 first appeared in SCOP 1.71
  
• d1w72d2 appears in SCOPe 2.06
  
• d1w72d2 appears in the current release, SCOPe 2.08