Lineage for d1w72h1 (1w72 H:1-113)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2352857Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (35 PDB entries)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
  8. 2352862Domain d1w72h1: 1w72 H:1-113 [114299]
    Other proteins in same PDB: d1w72a1, d1w72a2, d1w72b1, d1w72b2, d1w72d1, d1w72d2, d1w72e1, d1w72e2, d1w72h2, d1w72i2, d1w72l1, d1w72l2, d1w72m1, d1w72m2
    complexed with gol

Details for d1w72h1

PDB Entry: 1w72 (more details), 2.15 Å

PDB Description: crystal structure of hla-a1:mage-a1 in complex with fab-hyb3
PDB Compounds: (H:) hyb3 heavy chain

SCOPe Domain Sequences for d1w72h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w72h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
evqlvesggglvqpgrslrlscaasgftfddyamhwvrqapgkglewvsgiswnsgsigy
adsvkgrftisrdnaknslylqmnslraedtavyycargrgfhyyyygmdiwgqgttvtv
ss

SCOPe Domain Coordinates for d1w72h1:

Click to download the PDB-style file with coordinates for d1w72h1.
(The format of our PDB-style files is described here.)

Timeline for d1w72h1: