SCOPe 2.02: Domain d1w36g2: 1w36 G:361-606

Lineage for d1w36g2 (1w36 G:361-606)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Exodeoxyribonuclease V alpha chain (RecD) [117554] (1 species)
   contains extra N-terminal alpha+beta (sub)domain (~100 residues)

7. Species Escherichia coli [TaxId:562] [117555] (1 PDB entry)
   Uniprot P04993

8. Domain d1w36g2: 1w36 G:361-606 [114137]
   Other proteins in same PDB: d1w36b1, d1w36b2, d1w36b3, d1w36c1, d1w36c2, d1w36c3, d1w36e1, d1w36e2, d1w36e3, d1w36f1, d1w36f2, d1w36f3
   protein/DNA complex; complexed with ca

Details for d1w36g2

PDB Entry: 1w36, 3.1 Å

PDB Description: recbcd:dna complex

PDB Compounds: (G:) exodeoxyribonuclease v alpha chain

SCOPe Domain Sequences for d1w36g2:

Sequence, based on SEQRES records:

>d1w36g2 c.37.1.19 (G:361-606) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}
fgsdsgigqlaaainrgdktavktvfqqdftdiekrllqsgedyiamleealagygryld
llqaraepdliiqafneyqllcalregpfgvaglnerieqfmqqkrkihrhphsrwyegr
pvmiarndsalglfngdigialdrgqgtrvwfampdgniksvqpsrlpehettwamtvhk
sqgsefdhaalilpsqrtpvvtrelvytavtrarrrlslyaderilsaaiatrterrsgl
aalfss

Sequence, based on observed residues (ATOM records):

>d1w36g2 c.37.1.19 (G:361-606) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}
fgsdsgigqlaaainrgdktavktvfqqdftdiekrllqsgedyiamleealagygryld
llqaraepdliiqafneyqllcalregpfgvaglnerieqfmqqkrqpsrlpehettwam
tvhksqgsefdhaalilpsqrtpvvtrelvytavtrarrrlslyaderilsaaiatrter
rsglaalfss

Timeline for d1w36g2:

• d1w36g2 first appeared in SCOP 1.71
  
• d1w36g2 appears in SCOPe 2.01
  
• d1w36g2 appears in SCOPe 2.03
  
• d1w36g2 appears in the current release, SCOPe 2.08