Lineage for d1w36g2 (1w36 G:361-606)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. Protein Exodeoxyribonuclease V alpha chain (RecD), C-terminal domain [418967] (1 species)
  7. Species Escherichia coli [TaxId:562] [419429] (1 PDB entry)
    Uniprot P04993
  8. 2870714Domain d1w36g2: 1w36 G:361-606 [114137]
    Other proteins in same PDB: d1w36b1, d1w36b2, d1w36b3, d1w36c1, d1w36c2, d1w36c3, d1w36d1, d1w36e1, d1w36e2, d1w36e3, d1w36f1, d1w36f2, d1w36f3, d1w36g1
    protein/DNA complex; complexed with ca
    has additional insertions and/or extensions that are not grouped together

Details for d1w36g2

PDB Entry: 1w36 (more details), 3.1 Å

PDB Description: recbcd:dna complex
PDB Compounds: (G:) exodeoxyribonuclease v alpha chain

SCOPe Domain Sequences for d1w36g2:

Sequence, based on SEQRES records: (download)

>d1w36g2 c.37.1.19 (G:361-606) Exodeoxyribonuclease V alpha chain (RecD), C-terminal domain {Escherichia coli [TaxId: 562]}
fgsdsgigqlaaainrgdktavktvfqqdftdiekrllqsgedyiamleealagygryld
llqaraepdliiqafneyqllcalregpfgvaglnerieqfmqqkrkihrhphsrwyegr
pvmiarndsalglfngdigialdrgqgtrvwfampdgniksvqpsrlpehettwamtvhk
sqgsefdhaalilpsqrtpvvtrelvytavtrarrrlslyaderilsaaiatrterrsgl
aalfss

Sequence, based on observed residues (ATOM records): (download)

>d1w36g2 c.37.1.19 (G:361-606) Exodeoxyribonuclease V alpha chain (RecD), C-terminal domain {Escherichia coli [TaxId: 562]}
fgsdsgigqlaaainrgdktavktvfqqdftdiekrllqsgedyiamleealagygryld
llqaraepdliiqafneyqllcalregpfgvaglnerieqfmqqkrqpsrlpehettwam
tvhksqgsefdhaalilpsqrtpvvtrelvytavtrarrrlslyaderilsaaiatrter
rsglaalfss

SCOPe Domain Coordinates for d1w36g2:

Click to download the PDB-style file with coordinates for d1w36g2.
(The format of our PDB-style files is described here.)

Timeline for d1w36g2: