Lineage for d1vpza1 (1vpz A:1-55)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825104Fold b.151: CsrA-like [117129] (1 superfamily)
    sandwich; 10 strands in 2 sheets; intertwined dimer (segment-swapped, 5-stranded greek-key sandwich?)
  4. 2825105Superfamily b.151.1: CsrA-like [117130] (2 families) (S)
  5. 2825106Family b.151.1.1: CsrA-like [117131] (2 proteins)
    Pfam PF02599
  6. 2825107Protein Carbon storage regulator homolog, CsrA [117132] (2 species)
  7. 2825111Species Pseudomonas aeruginosa [TaxId:287] [117133] (1 PDB entry)
    Uniprot O69078
  8. 2825112Domain d1vpza1: 1vpz A:1-55 [113998]
    Other proteins in same PDB: d1vpza2, d1vpzb2
    Structural genomics target

Details for d1vpza1

PDB Entry: 1vpz (more details), 2.05 Å

PDB Description: crystal structure of a putative carbon storage regulator protein (csra, pa0905) from pseudomonas aeruginosa at 2.05 a resolution
PDB Compounds: (A:) carbon storage regulator homolog

SCOPe Domain Sequences for d1vpza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpza1 b.151.1.1 (A:1-55) Carbon storage regulator homolog, CsrA {Pseudomonas aeruginosa [TaxId: 287]}
mliltrrvgetlmvgddvtvtvlgvkgnqvrigvnapkevavhreeiyqriqkek

SCOPe Domain Coordinates for d1vpza1:

Click to download the PDB-style file with coordinates for d1vpza1.
(The format of our PDB-style files is described here.)

Timeline for d1vpza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vpza2