Lineage for d1vpza_ (1vpz A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 570188Fold b.151: CsrA-like [117129] (1 superfamily)
    sandwich; 10 strands in 2 sheets; intertwined dimer (segment-swapped, 5-stranded greek-key sandwich?)
  4. 570189Superfamily b.151.1: CsrA-like [117130] (1 family) (S)
  5. 570190Family b.151.1.1: CsrA-like [117131] (1 protein)
    Pfam 02599
  6. 570191Protein Carbon storage regulator homolog, CsrA [117132] (1 species)
  7. 570192Species Pseudomonas aeruginosa [TaxId:287] [117133] (1 PDB entry)
  8. 570193Domain d1vpza_: 1vpz A: [113998]

Details for d1vpza_

PDB Entry: 1vpz (more details), 2.05 Å

PDB Description: crystal structure of a putative carbon storage regulator protein (csra, pa0905) from pseudomonas aeruginosa at 2.05 a resolution

SCOP Domain Sequences for d1vpza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpza_ b.151.1.1 (A:) Carbon storage regulator homolog, CsrA {Pseudomonas aeruginosa}
hhmliltrrvgetlmvgddvtvtvlgvkgnqvrigvnapkevavhreeiyqriqkek

SCOP Domain Coordinates for d1vpza_:

Click to download the PDB-style file with coordinates for d1vpza_.
(The format of our PDB-style files is described here.)

Timeline for d1vpza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vpzb_