PDB entry 1vpz

View 1vpz on RCSB PDB site
Description: Crystal structure of a putative carbon storage regulator protein (csra, pa0905) from pseudomonas aeruginosa at 2.05 A resolution
Class: RNA binding protein
Keywords: Csra-like fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, rna binding protein
Deposited on 2004-11-24, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbon storage regulator homolog
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: csrA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69078 (12-End)
      • leader sequence (10-11)
      • modified residue (12)
      • modified residue (24)
    Domains in SCOPe 2.07: d1vpza1, d1vpza2
  • Chain 'B':
    Compound: carbon storage regulator homolog
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: csrA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69078 (12-End)
      • leader sequence (9-11)
      • modified residue (12)
      • modified residue (24)
    Domains in SCOPe 2.07: d1vpzb1, d1vpzb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vpzA (A:)
    mgsdkihhhhhhmliltrrvgetlmvgddvtvtvlgvkgnqvrigvnapkevavhreeiy
    qriqkekdqepnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpzA (A:)
    hhmliltrrvgetlmvgddvtvtvlgvkgnqvrigvnapkevavhreeiyqriqkek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vpzB (B:)
    mgsdkihhhhhhmliltrrvgetlmvgddvtvtvlgvkgnqvrigvnapkevavhreeiy
    qriqkekdqepnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpzB (B:)
    hhhmliltrrvgetlmvgddvtvtvlgvkgnqvrigvnapkevavhreeiyqriqk