Lineage for d1vpab1 (1vpa B:1-218)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2505843Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2505844Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2506554Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)
  6. 2506555Protein 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) [64140] (4 species)
  7. 2506588Species Thermotoga maritima [TaxId:2336] [117699] (1 PDB entry)
    Uniprot Q9X1B3
  8. 2506590Domain d1vpab1: 1vpa B:1-218 [113949]
    Other proteins in same PDB: d1vpaa2, d1vpab2
    Structural genomics target
    complexed with acy, ctp, mg

Details for d1vpab1

PDB Entry: 1vpa (more details), 2.67 Å

PDB Description: Crystal structure of 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (TM1393) from Thermotoga maritima at 2.67 A resolution
PDB Compounds: (B:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase

SCOPe Domain Sequences for d1vpab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpab1 c.68.1.13 (B:1-218) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima [TaxId: 2336]}
mnvaillaagkgermsenvpkqfleiegrmlfeyplstflkseaidgvvivtrrewfevv
ekrvfhekvlgiveggdtrsqsvrsaleflekfspsyvlvhdsarpflrkkhvsevlrra
retgaatlalknsdalvrvendrieyiprkgvyriltpqafsyeilkkahenggewaddt
epvqklgvkialvegdplcfkvtfkedlelariiarew

SCOPe Domain Coordinates for d1vpab1:

Click to download the PDB-style file with coordinates for d1vpab1.
(The format of our PDB-style files is described here.)

Timeline for d1vpab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vpab2