Lineage for d1vpab_ (1vpa B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 589782Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 589783Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (14 families) (S)
  5. 590036Family c.68.1.13: Cytidylytransferase [68901] (6 proteins)
  6. 590037Protein 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) [64140] (3 species)
  7. 590057Species Thermotoga maritima [TaxId:243274] [117699] (1 PDB entry)
  8. 590059Domain d1vpab_: 1vpa B: [113949]
    Structural genomics target
    complexed with acy, ctp, mg

Details for d1vpab_

PDB Entry: 1vpa (more details), 2.67 Å

PDB Description: Crystal structure of 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (TM1393) from Thermotoga maritima at 2.67 A resolution

SCOP Domain Sequences for d1vpab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpab_ c.68.1.13 (B:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima}
hhmnvaillaagkgermsenvpkqfleiegrmlfeyplstflkseaidgvvivtrrewfe
vvekrvfhekvlgiveggdtrsqsvrsaleflekfspsyvlvhdsarpflrkkhvsevlr
raretgaatlalknsdalvrvendrieyiprkgvyriltpqafsyeilkkahenggewad
dtepvqklgvkialvegdplcfkvtfkedlelariiarew

SCOP Domain Coordinates for d1vpab_:

Click to download the PDB-style file with coordinates for d1vpab_.
(The format of our PDB-style files is described here.)

Timeline for d1vpab_: