![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (14 families) ![]() |
![]() | Family c.68.1.13: Cytidylytransferase [68901] (6 proteins) |
![]() | Protein 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) [64140] (3 species) |
![]() | Species Thermotoga maritima [TaxId:243274] [117699] (1 PDB entry) |
![]() | Domain d1vpab_: 1vpa B: [113949] Structural genomics target complexed with acy, ctp, mg |
PDB Entry: 1vpa (more details), 2.67 Å
SCOP Domain Sequences for d1vpab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vpab_ c.68.1.13 (B:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima} hhmnvaillaagkgermsenvpkqfleiegrmlfeyplstflkseaidgvvivtrrewfe vvekrvfhekvlgiveggdtrsqsvrsaleflekfspsyvlvhdsarpflrkkhvsevlr raretgaatlalknsdalvrvendrieyiprkgvyriltpqafsyeilkkahenggewad dtepvqklgvkialvegdplcfkvtfkedlelariiarew
Timeline for d1vpab_: