Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.13: Cytidylytransferase [68901] (7 proteins) |
Protein 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) [64140] (4 species) |
Species Thermotoga maritima [TaxId:2336] [117699] (1 PDB entry) Uniprot Q9X1B3 |
Domain d1vpaa_: 1vpa A: [113948] Structural genomics target complexed with acy, ctp, mg |
PDB Entry: 1vpa (more details), 2.67 Å
SCOPe Domain Sequences for d1vpaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vpaa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima [TaxId: 2336]} hhmnvaillaagkgermsenvpkqfleiegrmlfeyplstflkseaidgvvivtrrewfe vvekrvfhekvlgiveggdtrsqsvrsaleflekfspsyvlvhdsarpflrkkhvsevlr raretgaatlalknsdalvrvendrieyiprkgvyriltpqafsyeilkkahenggewad dtepvqklgvkialvegdplcfkvtfkedlelariiarewe
Timeline for d1vpaa_: