![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
![]() | Family c.68.1.13: Cytidylytransferase [68901] (7 proteins) |
![]() | Protein 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) [64140] (4 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [117699] (1 PDB entry) Uniprot Q9X1B3 |
![]() | Domain d1vpaa1: 1vpa A:1-219 [113948] Other proteins in same PDB: d1vpaa2, d1vpab2 Structural genomics target complexed with acy, ctp, mg |
PDB Entry: 1vpa (more details), 2.67 Å
SCOPe Domain Sequences for d1vpaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vpaa1 c.68.1.13 (A:1-219) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima [TaxId: 2336]} mnvaillaagkgermsenvpkqfleiegrmlfeyplstflkseaidgvvivtrrewfevv ekrvfhekvlgiveggdtrsqsvrsaleflekfspsyvlvhdsarpflrkkhvsevlrra retgaatlalknsdalvrvendrieyiprkgvyriltpqafsyeilkkahenggewaddt epvqklgvkialvegdplcfkvtfkedlelariiarewe
Timeline for d1vpaa1: