Lineage for d1vpaa1 (1vpa A:1-219)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898986Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)
  6. 2898987Protein 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) [64140] (4 species)
  7. 2899020Species Thermotoga maritima [TaxId:2336] [117699] (1 PDB entry)
    Uniprot Q9X1B3
  8. 2899021Domain d1vpaa1: 1vpa A:1-219 [113948]
    Other proteins in same PDB: d1vpaa2, d1vpab2
    Structural genomics target
    complexed with acy, ctp, mg

Details for d1vpaa1

PDB Entry: 1vpa (more details), 2.67 Å

PDB Description: Crystal structure of 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (TM1393) from Thermotoga maritima at 2.67 A resolution
PDB Compounds: (A:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase

SCOPe Domain Sequences for d1vpaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpaa1 c.68.1.13 (A:1-219) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima [TaxId: 2336]}
mnvaillaagkgermsenvpkqfleiegrmlfeyplstflkseaidgvvivtrrewfevv
ekrvfhekvlgiveggdtrsqsvrsaleflekfspsyvlvhdsarpflrkkhvsevlrra
retgaatlalknsdalvrvendrieyiprkgvyriltpqafsyeilkkahenggewaddt
epvqklgvkialvegdplcfkvtfkedlelariiarewe

SCOPe Domain Coordinates for d1vpaa1:

Click to download the PDB-style file with coordinates for d1vpaa1.
(The format of our PDB-style files is described here.)

Timeline for d1vpaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vpaa2