SCOPe 2.08: Domain d1v8ya_: 1v8y A:

Lineage for d1v8ya_ (1v8y A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein ADP-ribose pyrophosphatase [64365] (4 species)

7. Species Thermus thermophilus [TaxId:274] [118083] (13 PDB entries)
   Uniprot Q84CU3

8. Domain d1v8ya_: 1v8y A: [113581]
   complexed with apr, zn; mutant
   has additional subdomain(s) that are not in the common domain

Details for d1v8ya_

PDB Entry: 1v8y, 1.65 Å

PDB Description: crystal structure analysis of the adp-ribose pyrophosphatase of e86q mutant, complexed with adp-ribose and zn

PDB Compounds: (A:) ADP-ribose pyrophosphatase

SCOPe Domain Sequences for d1v8ya_:

Sequence, based on SEQRES records:

>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]}
rtylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipaglie
pgedpleaarrelaeqtglsgdltylfsyfvspgftdekthvflaenlkeveahpdedea
ievvwmrpeealerhqrgevefsatglvgvlyyhaflr

Sequence, based on observed residues (ATOM records):

>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]}
rtylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipaglie
pgedpleaarrelaeqtglsgdltylfsyfvspgftdekthvflaenlkeveievvwmrp
eealerhqrgevefsatglvgvlyyhaflr

Timeline for d1v8ya_:

• d1v8ya_ first appeared in SCOP 1.71
  
• d1v8ya_ appears in SCOPe 2.07