Lineage for d1v8ya_ (1v8y A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609724Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 609725Superfamily d.113.1: Nudix [55811] (5 families) (S)
  5. 609726Family d.113.1.1: MutT-like [55812] (10 proteins)
  6. 609736Protein ADP-ribose pyrophosphatase [64365] (3 species)
  7. 609755Species Thermus thermophilus [TaxId:274] [118083] (10 PDB entries)
  8. 609756Domain d1v8ya_: 1v8y A: [113581]
    complexed with apr, zn; mutant

Details for d1v8ya_

PDB Entry: 1v8y (more details), 1.65 Å

PDB Description: crystal structure analysis of the adp-ribose pyrophosphatase of e86q mutant, complexed with adp-ribose and zn

SCOP Domain Sequences for d1v8ya_:

Sequence, based on SEQRES records: (download)

>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus}
rtylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipaglie
pgedpleaarrelaeqtglsgdltylfsyfvspgftdekthvflaenlkeveahpdedea
ievvwmrpeealerhqrgevefsatglvgvlyyhaflr

Sequence, based on observed residues (ATOM records): (download)

>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus}
rtylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipaglie
pgedpleaarrelaeqtglsgdltylfsyfvspgftdekthvflaenlkeveievvwmrp
eealerhqrgevefsatglvgvlyyhaflr

SCOP Domain Coordinates for d1v8ya_:

Click to download the PDB-style file with coordinates for d1v8ya_.
(The format of our PDB-style files is described here.)

Timeline for d1v8ya_: