Lineage for d1v5vb1 (1v5v B:313-401)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1544753Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544910Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (2 families) (S)
  5. 1544911Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (3 proteins)
  6. 1544912Protein Glycine cleavage system T protein, GcvT [110231] (4 species)
  7. 1544918Species Pyrococcus horikoshii [TaxId:53953] [117225] (1 PDB entry)
    Uniprot O58888
  8. 1544920Domain d1v5vb1: 1v5v B:313-401 [113541]
    Other proteins in same PDB: d1v5va2, d1v5vb2
    complexed with gol, peg

Details for d1v5vb1

PDB Entry: 1v5v (more details), 1.5 Å

PDB Description: Crystal Structure of a Component of Glycine Cleavage System: T-protein from Pyrococcus horikoshii OT3 at 1.5 A Resolution
PDB Compounds: (B:) Aminomethyltransferase

SCOPe Domain Sequences for d1v5vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5vb1 b.44.2.1 (B:313-401) Glycine cleavage system T protein, GcvT {Pyrococcus horikoshii [TaxId: 53953]}
rklvhfkmidkgipregykvyangemigevtsgtlspllnvgigiafvkeeyakpgieie
veirgqrkkavtvtppfydpkkyglfret

SCOPe Domain Coordinates for d1v5vb1:

Click to download the PDB-style file with coordinates for d1v5vb1.
(The format of our PDB-style files is described here.)

Timeline for d1v5vb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v5vb2