| Class b: All beta proteins [48724] (176 folds) |
| Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (2 families) ![]() |
| Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (3 proteins) |
| Protein Glycine cleavage system T protein, GcvT [110231] (4 species) |
| Species Pyrococcus horikoshii [TaxId:53953] [117225] (1 PDB entry) Uniprot O58888 |
| Domain d1v5vb1: 1v5v B:313-401 [113541] Other proteins in same PDB: d1v5va2, d1v5vb2 complexed with gol, peg |
PDB Entry: 1v5v (more details), 1.5 Å
SCOPe Domain Sequences for d1v5vb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v5vb1 b.44.2.1 (B:313-401) Glycine cleavage system T protein, GcvT {Pyrococcus horikoshii [TaxId: 53953]}
rklvhfkmidkgipregykvyangemigevtsgtlspllnvgigiafvkeeyakpgieie
veirgqrkkavtvtppfydpkkyglfret
Timeline for d1v5vb1: