SCOPe 2.03: Domain d1v5vb1: 1v5v B:313-401

Lineage for d1v5vb1 (1v5v B:313-401)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (2 families)

5. Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (3 proteins)

6. Protein Glycine cleavage system T protein, GcvT [110231] (4 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [117225] (1 PDB entry)
   Uniprot O58888

8. Domain d1v5vb1: 1v5v B:313-401 [113541]
   Other proteins in same PDB: d1v5va2, d1v5vb2
   complexed with gol, peg

Details for d1v5vb1

PDB Entry: 1v5v, 1.5 Å

PDB Description: Crystal Structure of a Component of Glycine Cleavage System: T-protein from Pyrococcus horikoshii OT3 at 1.5 A Resolution

PDB Compounds: (B:) Aminomethyltransferase

SCOPe Domain Sequences for d1v5vb1:

Sequence; same for both SEQRES and ATOM records:

>d1v5vb1 b.44.2.1 (B:313-401) Glycine cleavage system T protein, GcvT {Pyrococcus horikoshii [TaxId: 53953]}
rklvhfkmidkgipregykvyangemigevtsgtlspllnvgigiafvkeeyakpgieie
veirgqrkkavtvtppfydpkkyglfret

Timeline for d1v5vb1:

• d1v5vb1 first appeared in SCOP 1.71
  
• d1v5vb1 appears in SCOPe 2.02
  
• d1v5vb1 appears in SCOPe 2.04
  
• d1v5vb1 appears in the current release, SCOPe 2.08