Lineage for d1v5ca_ (1v5c A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722036Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2722054Family a.102.1.2: Cellulases catalytic domain [48213] (12 proteins)
  6. 2722070Protein Chitosanase [116987] (1 species)
  7. 2722071Species Bacillus sp., strain k17 [TaxId:1409] [116988] (2 PDB entries)
    Uniprot Q9ALZ1 49-434
  8. 2722074Domain d1v5ca_: 1v5c A: [113536]
    complexed with so4

Details for d1v5ca_

PDB Entry: 1v5c (more details), 2 Å

PDB Description: The crystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7
PDB Compounds: (A:) Chitosanase

SCOPe Domain Sequences for d1v5ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5ca_ a.102.1.2 (A:) Chitosanase {Bacillus sp., strain k17 [TaxId: 1409]}
akemkpfpqqvnyagvikpnhvtqeslnasvrsyydnwkkkylkndlsslpggyyvkgei
tgdadgfkplgtsegqgygmiitvlmagydsnaqkiydglfktartfkssqnpnlmgwvv
adskkaqghfdsatdgdldiayslllahkqwgsngtvnylkeaqdmitkgikasnvtnnn
qlnlgdwdskssldtrpsdwmmshlrafyeftgdktwltvinnlydvytqfsnkyspntg
lisdfvvknppqpapkdfldeseytnayyynasrvplrivmdyamygekrskvisdkvss
wiqnktngnpskivdgyqlngsnigsyptavfvspfiaasitssnnqkwvnsgwdwmknk
reryfsdsynlltmlfitgnwwkpvp

SCOPe Domain Coordinates for d1v5ca_:

Click to download the PDB-style file with coordinates for d1v5ca_.
(The format of our PDB-style files is described here.)

Timeline for d1v5ca_: