PDB entry 1v5c

View 1v5c on RCSB PDB site
Description: The crystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7
Class: hydrolase
Keywords: chitosan degradation, hydrolase, glycosil hydrolase, family 8
Deposited on 2003-11-22, released 2004-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chitosanase
    Species: Bacillus sp. [TaxId:1409]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V5C (0-385)
    Domains in SCOPe 2.08: d1v5ca_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v5cA (A:)
    akemkpfpqqvnyagvikpnhvtqeslnasvrsyydnwkkkylkndlsslpggyyvkgei
    tgdadgfkplgtsegqgygmiitvlmagydsnaqkiydglfktartfkssqnpnlmgwvv
    adskkaqghfdsatdgdldiayslllahkqwgsngtvnylkeaqdmitkgikasnvtnnn
    qlnlgdwdskssldtrpsdwmmshlrafyeftgdktwltvinnlydvytqfsnkyspntg
    lisdfvvknppqpapkdfldeseytnayyynasrvplrivmdyamygekrskvisdkvss
    wiqnktngnpskivdgyqlngsnigsyptavfvspfiaasitssnnqkwvnsgwdwmknk
    reryfsdsynlltmlfitgnwwkpvp