Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
Protein PII (product of glnB) [54915] (7 species) trimer with orthogonal packing of beta-sheets around the threefold axis |
Species Thermus thermophilus [TaxId:274] [102972] (5 PDB entries) Uniprot P83820 |
Domain d1v3sc_: 1v3s C: [113505] Structural genomics target complexed with atp |
PDB Entry: 1v3s (more details), 1.85 Å
SCOPe Domain Sequences for d1v3sc_:
Sequence, based on SEQRES records: (download)
>d1v3sc_ d.58.5.1 (C:) PII (product of glnB) {Thermus thermophilus [TaxId: 274]} mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeed
>d1v3sc_ d.58.5.1 (C:) PII (product of glnB) {Thermus thermophilus [TaxId: 274]} mklivaivrpeklnevlkalfqaevrgltlsrvqghglhekvrleigvsepfvkptveai lkaartgevgdgkifvlpvekvyrirtgeed
Timeline for d1v3sc_: