Lineage for d1v3sa_ (1v3s A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1651257Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1651258Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. 1651264Protein PII (product of glnB) [54915] (7 species)
    trimer with orthogonal packing of beta-sheets around the threefold axis
  7. 1651303Species Thermus thermophilus [TaxId:274] [102972] (5 PDB entries)
    Uniprot P83820
  8. 1651310Domain d1v3sa_: 1v3s A: [113503]
    Structural genomics target
    complexed with atp

Details for d1v3sa_

PDB Entry: 1v3s (more details), 1.85 Å

PDB Description: crystal structure of tt1020 from thermus thermophilus hb8
PDB Compounds: (A:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d1v3sa_:

Sequence, based on SEQRES records: (download)

>d1v3sa_ d.58.5.1 (A:) PII (product of glnB) {Thermus thermophilus [TaxId: 274]}
mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeedea

Sequence, based on observed residues (ATOM records): (download)

>d1v3sa_ d.58.5.1 (A:) PII (product of glnB) {Thermus thermophilus [TaxId: 274]}
mklivaivrpeklnevlkalfqaevrgltlsrvqghggetelhekvrleigvsepfvkpt
veailkaartgevgdgkifvlpvekvyrirtgeedea

SCOPe Domain Coordinates for d1v3sa_:

Click to download the PDB-style file with coordinates for d1v3sa_.
(The format of our PDB-style files is described here.)

Timeline for d1v3sa_: