Lineage for d1usye_ (1usy E:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1185373Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1185374Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1185375Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1185394Protein ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain [82559] (5 species)
    there is an additional C-terminal allosteric domain in some species
  7. 1185410Species Thermotoga maritima [TaxId:2336] [102699] (3 PDB entries)
    Uniprot Q9X0D2
  8. 1185415Domain d1usye_: 1usy E: [113426]
    Other proteins in same PDB: d1usya_, d1usyb_, d1usyc_, d1usyd_
    protein/RNA complex; complexed with his, po4

Details for d1usye_

PDB Entry: 1usy (more details), 2.52 Å

PDB Description: ATP phosphoribosyl transferase (HisG:HisZ) complex from Thermotoga maritima
PDB Compounds: (E:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d1usye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1usye_ c.94.1.1 (E:) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Thermotoga maritima [TaxId: 2336]}
mlklaipkgrleekvmtylkktgviferessilregkdivcfmvrpfdvptylvhgvadi
gfcgtdvlleketsliqpffiptnisrmvlagpkgrgipegekriatkfpnvtqrycesk
gwhcriiplkgsvelapiaglsdlivditetgrtlkennleildeifvirthvvvnpvsy
rtkreevvsfleklqeviehds

SCOPe Domain Coordinates for d1usye_:

Click to download the PDB-style file with coordinates for d1usye_.
(The format of our PDB-style files is described here.)

Timeline for d1usye_: