Lineage for d1upsa2 (1ups A:290-420)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2053527Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2053748Family b.42.2.3: GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain [117212] (1 protein)
  6. 2053749Protein GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain [117213] (1 species)
  7. 2053750Species Clostridium perfringens [TaxId:1502] [117214] (1 PDB entry)
    Uniprot Q934G8 17-420
  8. 2053751Domain d1upsa2: 1ups A:290-420 [113395]
    Other proteins in same PDB: d1upsa1, d1upsb1
    complexed with ca

Details for d1upsa2

PDB Entry: 1ups (more details), 1.82 Å

PDB Description: glcnac[alpha]1-4gal releasing endo-[beta]-galactosidase from clostridium perfringens
PDB Compounds: (A:) glcnac-alpha-1,4-gal-releasing endo-beta-galactosidase

SCOPe Domain Sequences for d1upsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]}
nnylirnrqtgkflyieenndkvsygditlkneknakwskeyrdgytllknnetgeylni
enqtgyiehgkvpktwwsaqwsevpvdgytrfvnrwkpnmsihtesyegvlqygnvpnty
wtsqwqlipve

SCOPe Domain Coordinates for d1upsa2:

Click to download the PDB-style file with coordinates for d1upsa2.
(The format of our PDB-style files is described here.)

Timeline for d1upsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1upsa1