![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) ![]() |
![]() | Family b.42.2.3: GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain [117212] (1 protein) |
![]() | Protein GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain [117213] (1 species) |
![]() | Species Clostridium perfringens [TaxId:1502] [117214] (1 PDB entry) Uniprot Q934G8 17-420 |
![]() | Domain d1upsa2: 1ups A:290-420 [113395] Other proteins in same PDB: d1upsa1, d1upsb1 complexed with ca |
PDB Entry: 1ups (more details), 1.82 Å
SCOPe Domain Sequences for d1upsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} nnylirnrqtgkflyieenndkvsygditlkneknakwskeyrdgytllknnetgeylni enqtgyiehgkvpktwwsaqwsevpvdgytrfvnrwkpnmsihtesyegvlqygnvpnty wtsqwqlipve
Timeline for d1upsa2: