SCOPe 2.08: Domain d1upsb2: 1ups B:290-420

Lineage for d1upsb2 (1ups B:290-420)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.3: GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain [117212] (1 protein)

6. Protein GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain [117213] (1 species)

7. Species Clostridium perfringens [TaxId:1502] [117214] (1 PDB entry)
   Uniprot Q934G8 17-420

8. Domain d1upsb2: 1ups B:290-420 [113397]
   Other proteins in same PDB: d1upsa1, d1upsb1
   complexed with ca

Details for d1upsb2

PDB Entry: 1ups, 1.82 Å

PDB Description: glcnac[alpha]1-4gal releasing endo-[beta]-galactosidase from clostridium perfringens

PDB Compounds: (B:) glcnac-alpha-1,4-gal-releasing endo-beta-galactosidase

SCOPe Domain Sequences for d1upsb2:

Sequence; same for both SEQRES and ATOM records:

>d1upsb2 b.42.2.3 (B:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]}
nnylirnrqtgkflyieenndkvsygditlkneknakwskeyrdgytllknnetgeylni
enqtgyiehgkvpktwwsaqwsevpvdgytrfvnrwkpnmsihtesyegvlqygnvpnty
wtsqwqlipve

Timeline for d1upsb2:

• d1upsb2 first appeared in SCOP 1.71
  
• d1upsb2 appears in SCOPe 2.07