PDB entry 1ups

View 1ups on RCSB PDB site
Description: glcnac[alpha]1-4gal releasing endo-[beta]-galactosidase from clostridium perfringens
Class: glycosyl hydrolase
Keywords: endo-galactosidase, clostridium perfringens, glycosyl hydrolase, psi, protein structure initiative, southeast collaboratory for structural genomics, secsg
Deposited on 2003-10-10, released 2004-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.177
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glcnac-alpha-1,4-gal-releasing endo-beta-galactosidase
    Species: Clostridium perfringens [TaxId:1502]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1upsa1, d1upsa2
  • Chain 'B':
    Compound: glcnac-alpha-1,4-gal-releasing endo-beta-galactosidase
    Species: Clostridium perfringens [TaxId:1502]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1upsb1, d1upsb2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1upsA (A:)
    mfvfmlllllpftiskakdfpanpiekagykldfsdefngptldrekwtdyylphwckdp
    esakanyrfengslveyitedqkpwcpehdgtvrssaimsfdkswihnfsgttdnherne
    wrgyttkygyfeiraklsntgggghqawwmvgmqddtndwfnskqtgeidiletffskkd
    twriaaygwndpnfqtswtisedkvpsgdptseyhiyamewtptalkfyydnelfkviyg
    spdyemgtilniytdagsgahndvwpkewaidymrvwkpvdgykeseslnnylirnrqtg
    kflyieenndkvsygditlkneknakwskeyrdgytllknnetgeylnienqtgyiehgk
    vpktwwsaqwsevpvdgytrfvnrwkpnmsihtesyegvlqygnvpntywtsqwqlipve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1upsA (A:)
    akdfpanpiekagykldfsdefngptldrekwtdyylphwckdpesakanyrfengslve
    yitedqkpwcpehdgtvrssaimsfdkswihnfsgttdnhernewrgyttkygyfeirak
    lsntgggghqawwmvgmqddtndwfnskqtgeidiletffskkdtwriaaygwndpnfqt
    swtisedkvpsgdptseyhiyamewtptalkfyydnelfkviygspdyemgtilniytda
    gsgahndvwpkewaidymrvwkpvdgykeslnnylirnrqtgkflyieenndkvsygdit
    lkneknakwskeyrdgytllknnetgeylnienqtgyiehgkvpktwwsaqwsevpvdgy
    trfvnrwkpnmsihtesyegvlqygnvpntywtsqwqlipve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1upsB (B:)
    mfvfmlllllpftiskakdfpanpiekagykldfsdefngptldrekwtdyylphwckdp
    esakanyrfengslveyitedqkpwcpehdgtvrssaimsfdkswihnfsgttdnherne
    wrgyttkygyfeiraklsntgggghqawwmvgmqddtndwfnskqtgeidiletffskkd
    twriaaygwndpnfqtswtisedkvpsgdptseyhiyamewtptalkfyydnelfkviyg
    spdyemgtilniytdagsgahndvwpkewaidymrvwkpvdgykeseslnnylirnrqtg
    kflyieenndkvsygditlkneknakwskeyrdgytllknnetgeylnienqtgyiehgk
    vpktwwsaqwsevpvdgytrfvnrwkpnmsihtesyegvlqygnvpntywtsqwqlipve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1upsB (B:)
    dfpanpiekagykldfsdefngptldrekwtdyylphwckdpesakanyrfengslveyi
    tedqkpwcpehdgtvrssaimsfdkswihnfsgttdnhernewrgyttkygyfeirakls
    ntgggghqawwmvgmqddtndwfnskqtgeidiletffskkdtwriaaygwndpnfqtsw
    tisedkvpsgdptseyhiyamewtptalkfyydnelfkviygspdyemgtilniytdags
    gahndvwpkewaidymrvwkpvdgyknnylirnrqtgkflyieenndkvsygditlknek
    nakwskeyrdgytllknnetgeylnienqtgyiehgkvpktwwsaqwsevpvdgytrfvn
    rwkpnmsihtesyegvlqygnvpntywtsqwqlipve