SCOPe 2.07: Domain d1um5l2: 1um5 L:110-217

Lineage for d1um5l2 (1um5 L:110-217)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (151 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d1um5l2: 1um5 L:110-217 [113305]
   Other proteins in same PDB: d1um5h1, d1um5h2, d1um5l1
   complexed with ss1

Details for d1um5l2

PDB Entry: 1um5, 1.6 Å

PDB Description: Catalytic Antibody 21H3 with alcohol substrate

PDB Compounds: (L:) Antibody 21H3 L chain

SCOPe Domain Sequences for d1um5l2:

Sequence; same for both SEQRES and ATOM records:

>d1um5l2 b.1.1.2 (L:110-217) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgecg

Timeline for d1um5l2:

• d1um5l2 first appeared in SCOP 1.71
  
• d1um5l2 appears in SCOPe 2.06
  
• d1um5l2 appears in the current release, SCOPe 2.08