Lineage for d1um5l2 (1um5 L:110-217)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2023413Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2023414Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 2023416Domain d1um5l2: 1um5 L:110-217 [113305]
    Other proteins in same PDB: d1um5h1, d1um5h2, d1um5l1
    complexed with ss1

Details for d1um5l2

PDB Entry: 1um5 (more details), 1.6 Å

PDB Description: Catalytic Antibody 21H3 with alcohol substrate
PDB Compounds: (L:) Antibody 21H3 L chain

SCOPe Domain Sequences for d1um5l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1um5l2 b.1.1.2 (L:110-217) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgecg

SCOPe Domain Coordinates for d1um5l2:

Click to download the PDB-style file with coordinates for d1um5l2.
(The format of our PDB-style files is described here.)

Timeline for d1um5l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1um5l1