SCOPe 2.02: Domain d1ua2b_: 1ua2 B:

Lineage for d1ua2b_ (1ua2 B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cell division protein kinase 7, CDK7 [118139] (1 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [118140] (1 PDB entry)
   Uniprot P50613 13-311

8. Domain d1ua2b_: 1ua2 B: [113252]
   complexed with atp

Details for d1ua2b_

PDB Entry: 1ua2, 3.02 Å

PDB Description: crystal structure of human cdk7

PDB Compounds: (B:) Cell division protein kinase 7

SCOPe Domain Sequences for d1ua2b_:

Sequence, based on SEQRES records:

>d1ua2b_ d.144.1.7 (B:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]}
ekldflgegqfatvykardkntnqivaikkiklghrseakdginrtalreikllqelshp
niiglldafghksnislvfdfmetdleviikdnslvltpshikaymlmtlqgleylhqhw
ilhrdlkpnnllldengvlkladfglaksfgspnraythqvvtrwyrapellfgarmygv
gvdmwavgcilaelllrvpflpgdsdldqltrifetlgtpteeqwpdmcslpdyvtfksf
pgiplhhifsaagddlldliqglflfnpcaritatqalkmkyfsnrpgptpgcqlprpn

Sequence, based on observed residues (ATOM records):

>d1ua2b_ d.144.1.7 (B:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]}
ekldflgegqfatvykardkntnqivaikkinrtalreikllqelshpniiglldafghk
snislvfdfmetdleviikdnslvltpshikaymlmtlqgleylhqhwilhrdlkpnnll
ldengvlkladfglaksfgspnraythqvvtrwyrapellfgarmygvgvdmwavgcila
elllrvpflpgdsdldqltrifetlgtpteeqwpdmcslpdyvtfksfpgiplhhifsaa
gddlldliqglflfnpcaritatqalkmkyfsnrpgptpgcqlprpn

Timeline for d1ua2b_:

• d1ua2b_ first appeared in SCOP 1.71
  
• d1ua2b_ appears in SCOPe 2.01
  
• d1ua2b_ appears in SCOPe 2.03
  
• d1ua2b_ appears in the current release, SCOPe 2.08