Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Cell division protein kinase 7, CDK7 [118139] (1 species) CMGC group; CDKs subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [118140] (1 PDB entry) Uniprot P50613 13-311 |
Domain d1ua2b_: 1ua2 B: [113252] complexed with atp |
PDB Entry: 1ua2 (more details), 3.02 Å
SCOPe Domain Sequences for d1ua2b_:
Sequence, based on SEQRES records: (download)
>d1ua2b_ d.144.1.7 (B:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} ekldflgegqfatvykardkntnqivaikkiklghrseakdginrtalreikllqelshp niiglldafghksnislvfdfmetdleviikdnslvltpshikaymlmtlqgleylhqhw ilhrdlkpnnllldengvlkladfglaksfgspnraythqvvtrwyrapellfgarmygv gvdmwavgcilaelllrvpflpgdsdldqltrifetlgtpteeqwpdmcslpdyvtfksf pgiplhhifsaagddlldliqglflfnpcaritatqalkmkyfsnrpgptpgcqlprpn
>d1ua2b_ d.144.1.7 (B:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} ekldflgegqfatvykardkntnqivaikkinrtalreikllqelshpniiglldafghk snislvfdfmetdleviikdnslvltpshikaymlmtlqgleylhqhwilhrdlkpnnll ldengvlkladfglaksfgspnraythqvvtrwyrapellfgarmygvgvdmwavgcila elllrvpflpgdsdldqltrifetlgtpteeqwpdmcslpdyvtfksfpgiplhhifsaa gddlldliqglflfnpcaritatqalkmkyfsnrpgptpgcqlprpn
Timeline for d1ua2b_: