Lineage for d1ua2a_ (1ua2 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2542913Protein Cell division protein kinase 7, CDK7 [118139] (1 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 2542914Species Human (Homo sapiens) [TaxId:9606] [118140] (1 PDB entry)
    Uniprot P50613 13-311
  8. 2542915Domain d1ua2a_: 1ua2 A: [113251]
    complexed with atp

Details for d1ua2a_

PDB Entry: 1ua2 (more details), 3.02 Å

PDB Description: crystal structure of human cdk7
PDB Compounds: (A:) Cell division protein kinase 7

SCOPe Domain Sequences for d1ua2a_:

Sequence, based on SEQRES records: (download)

>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]}
ekldflgegqfatvykardkntnqivaikkiklghrseakdginrtalreikllqelshp
niiglldafghksnislvfdfmetdleviikdnslvltpshikaymlmtlqgleylhqhw
ilhrdlkpnnllldengvlkladfglaksfgspnraythqvvtrwyrapellfgarmygv
gvdmwavgcilaelllrvpflpgdsdldqltrifetlgtpteeqwpdmcslpdyvtfksf
pgiplhhifsaagddlldliqglflfnpcaritatqalkmkyfsnrpgptpgcqlprpn

Sequence, based on observed residues (ATOM records): (download)

>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]}
ekldflgegqfatvykardkntnqivaikkinrtalreikllqelshpniiglldafghk
snislvfdfmetdleviikdnslvltpshikaymlmtlqgleylhqhwilhrdlkpnnll
ldengvlkladfglaksfgspnraythqvvtrwyrapellfgarmygvgvdmwavgcila
elllrvpflpgdsdldqltrifetlgtpteeqwpdmcslpdyvtfksfpgiplhhifsaa
gddlldliqglflfnpcaritatqalkmkyfsnrpgptpgcqlprpn

SCOPe Domain Coordinates for d1ua2a_:

Click to download the PDB-style file with coordinates for d1ua2a_.
(The format of our PDB-style files is described here.)

Timeline for d1ua2a_: