Lineage for d1u6mb_ (1u6m B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1037211Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1037212Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1037213Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1037484Protein Putative acetyltransferase EF0945 [118070] (1 species)
  7. 1037485Species Enterococcus faecalis [TaxId:1351] [118071] (1 PDB entry)
    Uniprot Q836Z8
  8. 1037487Domain d1u6mb_: 1u6m B: [113070]
    Structural genomics target
    complexed with so4

Details for d1u6mb_

PDB Entry: 1u6m (more details), 2.4 Å

PDB Description: the crystal structure of acetyltransferase
PDB Compounds: (B:) acetyltransferase, GNAT family

SCOPe Domain Sequences for d1u6mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6mb_ d.108.1.1 (B:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]}
slirsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqrilv
yehagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisvd
erfrgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisghl
ynhmqkeve

SCOPe Domain Coordinates for d1u6mb_:

Click to download the PDB-style file with coordinates for d1u6mb_.
(The format of our PDB-style files is described here.)

Timeline for d1u6mb_: