| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
| Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
| Protein Putative acetyltransferase EF0945 [118070] (1 species) |
| Species Enterococcus faecalis [TaxId:1351] [118071] (1 PDB entry) Uniprot Q836Z8 |
| Domain d1u6mb_: 1u6m B: [113070] Structural genomics target complexed with so4 |
PDB Entry: 1u6m (more details), 2.4 Å
SCOPe Domain Sequences for d1u6mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u6mb_ d.108.1.1 (B:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]}
slirsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqrilv
yehagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisvd
erfrgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisghl
ynhmqkeve
Timeline for d1u6mb_: