Lineage for d1u6mb1 (1u6m B:4-189)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968380Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2968662Protein Putative acetyltransferase EF0945 [118070] (1 species)
  7. 2968663Species Enterococcus faecalis [TaxId:1351] [118071] (1 PDB entry)
    Uniprot Q836Z8
  8. 2968665Domain d1u6mb1: 1u6m B:4-189 [113070]
    Other proteins in same PDB: d1u6ma2, d1u6ma3, d1u6mb2, d1u6mb3, d1u6mc2, d1u6mc3, d1u6md2, d1u6md3
    Structural genomics target
    complexed with so4

    has additional insertions and/or extensions that are not grouped together

Details for d1u6mb1

PDB Entry: 1u6m (more details), 2.4 Å

PDB Description: the crystal structure of acetyltransferase
PDB Compounds: (B:) acetyltransferase, GNAT family

SCOPe Domain Sequences for d1u6mb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6mb1 d.108.1.1 (B:4-189) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]}
irsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqrilvye
hagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisvder
frgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisghlyn
hmqkev

SCOPe Domain Coordinates for d1u6mb1:

Click to download the PDB-style file with coordinates for d1u6mb1.
(The format of our PDB-style files is described here.)

Timeline for d1u6mb1: