SCOPe 2.08: Domain d1u25a_: 1u25 A:

Lineage for d1u25a_ (1u25 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.4: Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117583] (2 proteins)

6. Protein Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117584] (1 species)

7. Species Selenomonas ruminantium [TaxId:971] [117585] (12 PDB entries)
   Uniprot Q7WUJ1 34-346

8. Domain d1u25a_: 1u25 A: [112970]
   Other proteins in same PDB: d1u25b2
   complexed with ihs

Details for d1u25a_

PDB Entry: 1u25, 2.5 Å

PDB Description: Crystal structure of Selenomonas ruminantium phytase complexed with persulfated phytate in the C2221 crystal form

PDB Compounds: (A:) myo-inositol hexaphosphate phosphohydrolase

SCOPe Domain Sequences for d1u25a_:

Sequence; same for both SEQRES and ATOM records:

>d1u25a_ c.45.1.4 (A:) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]}
tepvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayvpsre
gmdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswygerdwa
nlgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaeaagmr
yfriaatdhvwptpenidrflafyrtlpqdawlhfhceagvgrttafmvmtdmlknpsvs
lkdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgyqtpw
svwlkshpaka

Timeline for d1u25a_:

• d1u25a_ first appeared in SCOP 1.71
  
• d1u25a_ appears in SCOPe 2.07