Lineage for d1u25c_ (1u25 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875718Family c.45.1.4: Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117583] (2 proteins)
  6. 2875719Protein Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117584] (1 species)
  7. 2875720Species Selenomonas ruminantium [TaxId:971] [117585] (12 PDB entries)
    Uniprot Q7WUJ1 34-346
  8. 2875733Domain d1u25c_: 1u25 C: [112972]
    Other proteins in same PDB: d1u25b2
    complexed with ihs

Details for d1u25c_

PDB Entry: 1u25 (more details), 2.5 Å

PDB Description: Crystal structure of Selenomonas ruminantium phytase complexed with persulfated phytate in the C2221 crystal form
PDB Compounds: (C:) myo-inositol hexaphosphate phosphohydrolase

SCOPe Domain Sequences for d1u25c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u25c_ c.45.1.4 (C:) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]}
epvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayvpsreg
mdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswygerdwan
lgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaeaagmry
friaatdhvwptpenidrflafyrtlpqdawlhfhceagvgrttafmvmtdmlknpsvsl
kdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgyqtpws
vwlkshpaka

SCOPe Domain Coordinates for d1u25c_:

Click to download the PDB-style file with coordinates for d1u25c_.
(The format of our PDB-style files is described here.)

Timeline for d1u25c_: