PDB entry 1u25

View 1u25 on RCSB PDB site
Description: Crystal structure of Selenomonas ruminantium phytase complexed with persulfated phytate in the C2221 crystal form
Class: hydrolase
Keywords: PTP, P-loop, phytase, hydrolase
Deposited on 2004-07-16, released 2004-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.179
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myo-inositol hexaphosphate phosphohydrolase
    Species: Selenomonas ruminantium [TaxId:971]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u25a_
  • Chain 'B':
    Compound: myo-inositol hexaphosphate phosphohydrolase
    Species: Selenomonas ruminantium [TaxId:971]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WUJ1 (Start-334)
      • expression tag (335)
    Domains in SCOPe 2.07: d1u25b1, d1u25b2
  • Chain 'C':
    Compound: myo-inositol hexaphosphate phosphohydrolase
    Species: Selenomonas ruminantium [TaxId:971]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u25c_
  • Heterogens: IHS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u25A (A:)
    masmtggqqmgrgsefakapeqtvtepvgsyaraerpqdfegfvwrldndgkealprnfr
    tsadalrapekkfhldaayvpsregmdalhisgssaftpaqlknvaaklrektagpiydv
    dlrqeshgyldgipvswygerdwanlgksqhealaderhrlhaalhktvyiaplgkhklp
    eggevrrvqkvqteqevaeaagmryfriaatdhvwptpenidrflafyrtlpqdawlhfh
    ceagvgrttafmvmtdmlknpsvslkdilyrqheiggfyygefpiktkdkdswktkyyre
    kivmieqfyryvqenradgyqtpwsvwlkshpakale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u25A (A:)
    tepvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayvpsre
    gmdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswygerdwa
    nlgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaeaagmr
    yfriaatdhvwptpenidrflafyrtlpqdawlhfhceagvgrttafmvmtdmlknpsvs
    lkdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgyqtpw
    svwlkshpaka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u25B (B:)
    masmtggqqmgrgsefakapeqtvtepvgsyaraerpqdfegfvwrldndgkealprnfr
    tsadalrapekkfhldaayvpsregmdalhisgssaftpaqlknvaaklrektagpiydv
    dlrqeshgyldgipvswygerdwanlgksqhealaderhrlhaalhktvyiaplgkhklp
    eggevrrvqkvqteqevaeaagmryfriaatdhvwptpenidrflafyrtlpqdawlhfh
    ceagvgrttafmvmtdmlknpsvslkdilyrqheiggfyygefpiktkdkdswktkyyre
    kivmieqfyryvqenradgyqtpwsvwlkshpakale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u25B (B:)
    tepvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayvpsre
    gmdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswygerdwa
    nlgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaeaagmr
    yfriaatdhvwptpenidrflafyrtlpqdawlhfhceagvgrttafmvmtdmlknpsvs
    lkdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgyqtpw
    svwlkshpakal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u25C (C:)
    masmtggqqmgrgsefakapeqtvtepvgsyaraerpqdfegfvwrldndgkealprnfr
    tsadalrapekkfhldaayvpsregmdalhisgssaftpaqlknvaaklrektagpiydv
    dlrqeshgyldgipvswygerdwanlgksqhealaderhrlhaalhktvyiaplgkhklp
    eggevrrvqkvqteqevaeaagmryfriaatdhvwptpenidrflafyrtlpqdawlhfh
    ceagvgrttafmvmtdmlknpsvslkdilyrqheiggfyygefpiktkdkdswktkyyre
    kivmieqfyryvqenradgyqtpwsvwlkshpakale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u25C (C:)
    epvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayvpsreg
    mdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswygerdwan
    lgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaeaagmry
    friaatdhvwptpenidrflafyrtlpqdawlhfhceagvgrttafmvmtdmlknpsvsl
    kdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgyqtpws
    vwlkshpaka