SCOPe 2.08: Domain d1u0bb1: 1u0b B:316-461

Lineage for d1u0bb1 (1u0b B:316-461)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)

6. Protein Cysteinyl-tRNA synthetase (CysRS) [74709] (1 species)
   contains extra C-terminal alpha+beta subdomain: [alpha(2)-beta(2)], ordered in the complex with tRNA

7. Species Escherichia coli [TaxId:562] [74710] (3 PDB entries)
   Uniprot P21888; extra C-terminal subdomain: 407-461

8. Domain d1u0bb1: 1u0b B:316-461 [112904]
   Other proteins in same PDB: d1u0bb2
   protein/RNA complex; complexed with zn
   has additional subdomain(s) that are not in the common domain

Details for d1u0bb1

PDB Entry: 1u0b, 2.3 Å

PDB Description: Crystal structure of cysteinyl-tRNA synthetase binary complex with tRNACys

PDB Compounds: (B:) cysteinyl tRNA

SCOPe Domain Sequences for d1u0bb1:

Sequence; same for both SEQRES and ATOM records:

>d1u0bb1 a.27.1.1 (B:316-461) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]}
lerlytalrgtdktvapaggeafearfieamdddfntpeaysvlfdmarevnrlkaedma
aanamashlrklsavlglleqepeaflqsgaqaddsevaeiealiqqrldarkakdwaaa
daardrlnemgivledgpqgttwrrk

Timeline for d1u0bb1:

• d1u0bb1 first appeared in SCOP 1.71
  
• d1u0bb1 appears in SCOPe 2.07