![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins) barrel, closed; n=5, S=10 |
![]() | Protein Primosomal replication protein N, PriB [117191] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [117192] (2 PDB entries) Uniprot P07013 |
![]() | Domain d1txyb_: 1txy B: [112792] missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1txy (more details), 2 Å
SCOPe Domain Sequences for d1txyb_:
Sequence, based on SEQRES records: (download)
>d1txyb_ b.40.4.3 (B:) Primosomal replication protein N, PriB {Escherichia coli [TaxId: 562]} mtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsghenq aithsitvgsritvqgfischkaknglskmvlhaeqie
>d1txyb_ b.40.4.3 (B:) Primosomal replication protein N, PriB {Escherichia coli [TaxId: 562]} mtnrlvlsgtvcraplrkphcqfvlehrsvqeeagfhrqawcqmpvivsghenqaithsi tvgsritvqgfischmvlhaeqie
Timeline for d1txyb_: