SCOPe 2.08: Domain d1txya_: 1txy A:

Lineage for d1txya_ (1txy A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
   barrel, closed; n=5, S=10

6. Protein Primosomal replication protein N, PriB [117191] (1 species)

7. Species Escherichia coli [TaxId:562] [117192] (2 PDB entries)
   Uniprot P07013

8. Domain d1txya_: 1txy A: [112791]
   missing some secondary structures that made up less than one-third of the common domain

Details for d1txya_

PDB Entry: 1txy, 2 Å

PDB Description: E. coli PriB

PDB Compounds: (A:) primosomal replication protein n

SCOPe Domain Sequences for d1txya_:

Sequence, based on SEQRES records:

>d1txya_ b.40.4.3 (A:) Primosomal replication protein N, PriB {Escherichia coli [TaxId: 562]}
mtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsghenq
aithsitvgsritvqgfischkaknglskmvlhaeqieli

Sequence, based on observed residues (ATOM records):

>d1txya_ b.40.4.3 (A:) Primosomal replication protein N, PriB {Escherichia coli [TaxId: 562]}
mtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsghenq
aithsitvgsritvqgfisckmvlhaeqieli

Timeline for d1txya_:

• d1txya_ first appeared in SCOP 1.71
  
• d1txya_ appears in SCOPe 2.07