Lineage for d1txya_ (1txy A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789342Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
    barrel, closed; n=5, S=10
  6. 2789388Protein Primosomal replication protein N, PriB [117191] (1 species)
  7. 2789389Species Escherichia coli [TaxId:562] [117192] (2 PDB entries)
    Uniprot P07013
  8. 2789392Domain d1txya_: 1txy A: [112791]
    missing some secondary structures that made up less than one-third of the common domain

Details for d1txya_

PDB Entry: 1txy (more details), 2 Å

PDB Description: E. coli PriB
PDB Compounds: (A:) primosomal replication protein n

SCOPe Domain Sequences for d1txya_:

Sequence, based on SEQRES records: (download)

>d1txya_ b.40.4.3 (A:) Primosomal replication protein N, PriB {Escherichia coli [TaxId: 562]}
mtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsghenq
aithsitvgsritvqgfischkaknglskmvlhaeqieli

Sequence, based on observed residues (ATOM records): (download)

>d1txya_ b.40.4.3 (A:) Primosomal replication protein N, PriB {Escherichia coli [TaxId: 562]}
mtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsghenq
aithsitvgsritvqgfisckmvlhaeqieli

SCOPe Domain Coordinates for d1txya_:

Click to download the PDB-style file with coordinates for d1txya_.
(The format of our PDB-style files is described here.)

Timeline for d1txya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1txyb_