Lineage for d1twff_ (1twf F:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017141Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2017142Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2017191Family a.143.1.2: RPB6 [55294] (2 proteins)
  6. 2017192Protein RPB6 [55295] (3 species)
    essential subunit of RNA polymerases I, II and III
  7. 2017193Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (30 PDB entries)
    Uniprot P20435; part of multichain biological unit
  8. 2017194Domain d1twff_: 1twf F: [112731]
    Other proteins in same PDB: d1twfa_, d1twfb_, d1twfc1, d1twfc2, d1twfe1, d1twfe2, d1twfh_, d1twfi1, d1twfi2, d1twfj_, d1twfk_, d1twfl_
    protein/RNA complex; complexed with mn, utp, zn

Details for d1twff_

PDB Entry: 1twf (more details), 2.3 Å

PDB Description: RNA polymerase II complexed with UTP at 2.3 A resolution
PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOPe Domain Sequences for d1twff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twff_ a.143.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

SCOPe Domain Coordinates for d1twff_:

Click to download the PDB-style file with coordinates for d1twff_.
(The format of our PDB-style files is described here.)

Timeline for d1twff_: