SCOPe 2.06: Domain d1twfc2: 1twf C:42-172

Lineage for d1twfc2 (1twf C:42-172)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)
   automatically mapped to Pfam PF01000

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)

6. Protein RPB3 [64462] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries)
   Uniprot P16370; part of multichain biological unit

8. Domain d1twfc2: 1twf C:42-172 [112728]
   Other proteins in same PDB: d1twfa_, d1twfb_, d1twfc1, d1twfe1, d1twfe2, d1twff_, d1twfh_, d1twfi1, d1twfi2, d1twfj_, d1twfk_, d1twfl_
   protein/RNA complex; complexed with mn, utp, zn

Details for d1twfc2

PDB Entry: 1twf, 2.3 Å

PDB Description: RNA polymerase II complexed with UTP at 2.3 A resolution

PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOPe Domain Sequences for d1twfc2:

Sequence; same for both SEQRES and ATOM records:

>d1twfc2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

Timeline for d1twfc2:

• d1twfc2 first appeared in SCOP 1.71
  
• d1twfc2 appears in SCOPe 2.05
  
• d1twfc2 appears in SCOPe 2.07
  
• d1twfc2 appears in the current release, SCOPe 2.08