| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) ![]() |
| Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein) |
| Protein Eukaryotic RPB5 N-terminal domain [53038] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (25 PDB entries) Uniprot P20434; part of multichain biological unit |
| Domain d1twfe1: 1twf E:1-143 [112729] Other proteins in same PDB: d1twfa_, d1twfb_, d1twfc1, d1twfc2, d1twfe2, d1twff_, d1twfh_, d1twfi1, d1twfi2, d1twfj_, d1twfk_, d1twfl_ protein/RNA complex; complexed with mn, utp, zn |
PDB Entry: 1twf (more details), 2.3 Å
SCOPe Domain Sequences for d1twfe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twfe1 c.52.3.1 (E:1-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsf
qanpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsa
mklvpsippatietfneaalvvn
Timeline for d1twfe1: