Lineage for d1twfe2 (1twf E:144-215)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1032033Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 1032034Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (1 family) (S)
  5. 1032035Family d.78.1.1: RPB5 [55288] (2 proteins)
  6. 1032036Protein Eukaryotic RPB5 C-terminal domain [55292] (1 species)
  7. 1032037Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (25 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 1032039Domain d1twfe2: 1twf E:144-215 [112730]
    Other proteins in same PDB: d1twfa_, d1twfb_, d1twfc1, d1twfc2, d1twfe1, d1twff_, d1twfh_, d1twfi1, d1twfi2, d1twfj_, d1twfk_, d1twfl_
    protein/RNA complex; complexed with mn, utp, zn

Details for d1twfe2

PDB Entry: 1twf (more details), 2.3 Å

PDB Description: RNA polymerase II complexed with UTP at 2.3 A resolution
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOPe Domain Sequences for d1twfe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twfe2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOPe Domain Coordinates for d1twfe2:

Click to download the PDB-style file with coordinates for d1twfe2.
(The format of our PDB-style files is described here.)

Timeline for d1twfe2: