SCOPe 2.05: Domain d1twea_: 1twe A:

Lineage for d1twea_ (1twe A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins)

6. Protein Interleukin-1beta [50363] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50364] (25 PDB entries)
   Uniprot P01584 117-269

8. Domain d1twea_: 1twe A: [112724]
   mutant

Details for d1twea_

PDB Entry: 1twe, 2.1 Å

PDB Description: interleukin 1 beta mutant f101y

PDB Compounds: (A:) interleukin-1 beta

SCOPe Domain Sequences for d1twea_:

Sequence; same for both SEQRES and ATOM records:

>d1twea_ b.42.1.2 (A:) Interleukin-1beta {Human (Homo sapiens) [TaxId: 9606]}
apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvynkieinnklefesaqfpnw
yistsqaenmpvflggtkggqditdftmqfvss

Timeline for d1twea_:

• d1twea_ first appeared in SCOP 1.71
  
• d1twea_ appears in SCOPe 2.04
  
• d1twea_ appears in SCOPe 2.06
  
• d1twea_ appears in the current release, SCOPe 2.08