Lineage for d1twea_ (1twe A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 560566Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 560567Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 560703Family b.42.1.2: Interleukin-1 (IL-1) [50362] (5 proteins)
  6. 560720Protein Interleukin-1beta [50363] (2 species)
  7. 560721Species Human (Homo sapiens) [TaxId:9606] [50364] (19 PDB entries)
  8. 560728Domain d1twea_: 1twe A: [112724]
    mutant

Details for d1twea_

PDB Entry: 1twe (more details), 2.1 Å

PDB Description: interleukin 1 beta mutant f101y

SCOP Domain Sequences for d1twea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twea_ b.42.1.2 (A:) Interleukin-1beta {Human (Homo sapiens)}
apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvynkieinnklefesaqfpnw
yistsqaenmpvflggtkggqditdftmqfvss

SCOP Domain Coordinates for d1twea_:

Click to download the PDB-style file with coordinates for d1twea_.
(The format of our PDB-style files is described here.)

Timeline for d1twea_: