Lineage for d1twac1 (1twa C:3-41,C:173-268)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958148Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2958149Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)
  6. 2958229Protein RPB3 [64315] (2 species)
  7. 2958230Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries)
    Uniprot P16370; part of multichain biological unit
  8. 2958235Domain d1twac1: 1twa C:3-41,C:173-268 [112698]
    Other proteins in same PDB: d1twaa_, d1twab_, d1twac2, d1twae1, d1twae2, d1twaf_, d1twah_, d1twai1, d1twai2, d1twaj_, d1twak_, d1twal_
    protein/RNA complex; complexed with atp, mn, zn

Details for d1twac1

PDB Entry: 1twa (more details), 3.2 Å

PDB Description: RNA polymerase II complexed with ATP
PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOPe Domain Sequences for d1twac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twac1 d.74.3.1 (C:3-41,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eegpqvkireaskdnvdfilsnvdlamanslrrvmiaeiXaaaiefeydpwnklkhtdyw
yeqdsakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlq
kkvasillaltqmdqd

SCOPe Domain Coordinates for d1twac1:

Click to download the PDB-style file with coordinates for d1twac1.
(The format of our PDB-style files is described here.)

Timeline for d1twac1: