SCOPe 2.08: Domain d1twae1: 1twa E:1-143

Lineage for d1twae1 (1twa E:1-143)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family)

5. Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins)

6. Protein Eukaryotic RPB5 N-terminal domain [53038] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (27 PDB entries)
   Uniprot P20434; part of multichain biological unit

8. Domain d1twae1: 1twa E:1-143 [112700]
   Other proteins in same PDB: d1twaa_, d1twab_, d1twac1, d1twac2, d1twae2, d1twaf_, d1twah_, d1twai1, d1twai2, d1twaj_, d1twak_, d1twal_
   protein/RNA complex; complexed with atp, mn, zn

Details for d1twae1

PDB Entry: 1twa, 3.2 Å

PDB Description: RNA polymerase II complexed with ATP

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOPe Domain Sequences for d1twae1:

Sequence; same for both SEQRES and ATOM records:

>d1twae1 c.52.3.1 (E:1-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsf
qanpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsa
mklvpsippatietfneaalvvn

Timeline for d1twae1:

• d1twae1 first appeared in SCOP 1.71
  
• d1twae1 appears in SCOPe 2.07